H00128240-B01

NAXE antibody from Abnova Corporation
AIBP, APOA1BP, MGC119143, MGC119144, MGC119145, YJEFN1

Antibody data

Product number
H00128240-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00128240-B01, RRID:AB_1137747
Product name
APOA1BP MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00128240-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human APOA1BP protein.
Antigen sequence
MSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEP
TIYYPKRPNKPLFTALVTQCQKMDIPFLGEMPAEP
MTIDELYELVVDAIFGFSFKGDVREPFHSILSVLK
GLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTA
PKKSATQFTGRYHYLGGRFVPPALEKKYQLNLPPY
PDTECVYRLQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -