HPA030280

LRRC71 antibody from MilliporeSigma / Merck KGaA
C1orf92, FLJ32884
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030280
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030280, RRID:AB_10600336
Product name
Anti-C1orf92 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030280
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein C10orf92 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNRSLLWLSLAHNRIQDKGALKLAEVLRAFELTHT
EVVERRRLLLEKGTQERSRSPSSSRHGDSKTDREK
SQMVGISNSALVDKTDKTQTMKTPKG
Storage
-20C
Provider Type Product Number
- No reagents -