H00007141-M04A

TNP1 antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00007141-M04A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007141-M04A, RRID:AB_1137501
Product name
TNP1 monoclonal antibody (M04A), clone 4F12
Provider product page
Abnova Corporation - H00007141-M04A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TNP1.
Antigen sequence
MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRK
GNLKSRKRGDDANRNYRSHL
Isotype
IgM
Antibody clone number
4F12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -