Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009447-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009447-B01P, RRID:AB_1571006
- Product name
- AIM2 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human AIM2 protein.
- Antigen sequence
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNI
ATGKLHTANRIQVATLMIQNAGAVSAVMKTIRIFQ
KLNYMLLAKRLQEEKEKVDKQYKSVTKPKPLSQAE
MSPAASAAIRNDVAKQRAAPKVSPHVKPEQKQMVA
QQESIREGFQKRCLPVMVLKAKKPFTFETQEGKQE
MFHATVATEKEFFFVKVFNTLLKDKFIPKRIIIIA
RYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRK
AGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNI
LFDLSDNTGKMEVLGVRNEDTMKCKEGDKVRLTFF
TLSKNGEKLQLTSGVHSTIKVIKAKKKT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Constitutive interferon-inducible protein 16-inflammasome activation during Epstein-Barr virus latency I, II, and III in B and epithelial cells.
Interactome-wide analysis identifies end-binding protein 1 as a crucial component for the speck-like particle formation of activated absence in melanoma 2 (AIM2) inflammasomes.
Absent in Melanoma 2 (AIM2) is an important mediator of interferon-dependent and -independent HLA-DRA and HLA-DRB gene expression in colorectal cancers.
AIM2 activates the inflammasome and cell death in response to cytoplasmic DNA.
Ansari MA, Singh VV, Dutta S, Veettil MV, Dutta D, Chikoti L, Lu J, Everly D, Chandran B
Journal of virology 2013 Aug;87(15):8606-23
Journal of virology 2013 Aug;87(15):8606-23
Interactome-wide analysis identifies end-binding protein 1 as a crucial component for the speck-like particle formation of activated absence in melanoma 2 (AIM2) inflammasomes.
Wang LJ, Hsu CW, Chen CC, Liang Y, Chen LC, Ojcius DM, Tsang NM, Hsueh C, Wu CC, Chang YS
Molecular & cellular proteomics : MCP 2012 Nov;11(11):1230-44
Molecular & cellular proteomics : MCP 2012 Nov;11(11):1230-44
Absent in Melanoma 2 (AIM2) is an important mediator of interferon-dependent and -independent HLA-DRA and HLA-DRB gene expression in colorectal cancers.
Lee J, Li L, Gretz N, Gebert J, Dihlmann S
Oncogene 2012 Mar 8;31(10):1242-53
Oncogene 2012 Mar 8;31(10):1242-53
AIM2 activates the inflammasome and cell death in response to cytoplasmic DNA.
Fernandes-Alnemri T, Yu JW, Datta P, Wu J, Alnemri ES
Nature 2009 Mar 26;458(7237):509-13
Nature 2009 Mar 26;458(7237):509-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AIM2 expression in transfected 293T cell line by AIM2 MaxPab polyclonal antibody.Lane 1: AIM2 transfected lysate(37.73 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to AIM2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol