Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000014-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000014-M02, RRID:AB_1570782
- Product name
- AAMP monoclonal antibody (M02), clone 2H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant AAMP.
- Antigen sequence
GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHD
STLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWM
EWHPRAPVLLAGTADGNTWMWKVPNGDCKT- Isotype
- IgG
- Antibody clone number
- 2H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The impact of angio-associated migratory cell protein (AAMP) on breast cancer cells in vitro and its clinical significance.
Yin Y, Sanders AJ, Jiang WG
Anticancer research 2013 Apr;33(4):1499-509
Anticancer research 2013 Apr;33(4):1499-509
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged AAMP is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol