HPA047418

PIGM antibody from Atlas Antibodies
GPI-MT-I

Antibody data

Product number
HPA047418
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA047418, RRID:AB_2680039
Product name
Anti-PIGM
Provider product page
Atlas Antibodies - HPA047418
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRAT
YRYT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.