H00005824-B02

PEX19 antibody from Abnova Corporation
D1S2223E, HK33, PMP1, PMPI, PXF, PXMP1

Antibody data

Product number
H00005824-B02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005824-B02, RRID:AB_1204782
Product name
PEX19 MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00005824-B02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PEX19 protein.
Antigen sequence
MAAAEEGCSVGAEADRELEELLESALDDFDKAKPS
PAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKF
FQELFDSELASQATAEFEKAMKELAEEEPHLVEQF
QKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNA
TDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIM
QGIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESL
PPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQK
ARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDL
DAPNLSGPPGASGEQCLIM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -