Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311471 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Coatomer Protein Complex, Subunit alpha (COPA) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-COPA antibody: synthetic peptide directed towards the N terminal of human COPA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRG
IDFHK QQPLFVSGGD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The spinal muscular atrophy disease protein SMN is linked to the Golgi network.
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Ting CH, Wen HL, Liu HC, Hsieh-Li HM, Li H, Lin-Chao S
PloS one 2012;7(12):e51826
PloS one 2012;7(12):e51826
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
Cell 2006 Nov 3;127(3):635-48
Cell 2006 Nov 3;127(3):635-48
No comments: Submit comment
No validations: Submit validation data