HPA028024

COPA antibody from Sigma-Aldrich
HEP-COP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028024
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028024, RRID:AB_10603787
Product name
Anti-COPA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028024
Antibody type
Polyclonal
Antigen
coatomer protein complex, subunit alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSGSK
FPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIP
KDADSQNPDAPEGKRSSGLTAVWVARN
Storage
-20C
Provider Type Product Number
- No reagents -