HPA027043

VANGL2 antibody from Sigma-Aldrich
KIAA1215, LPP1, LTAP, MGC119403, MGC119404, STB1, STBM, STBM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027043
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027043, RRID:AB_10601709
Product name
Anti-VANGL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027043
Antibody type
Polyclonal
Antigen
vang-like 2 (van gogh, Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWI
LEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSL
GEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEE
AEHERRV
Storage
-20C
Provider Type Product Number
- No reagents -