Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000617-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000617-M01, RRID:AB_509259
- Product name
- BCS1L monoclonal antibody (M01), clone 5F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BCS1L.
- Antigen sequence
ASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYVG
YCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATN
QISPAQVQGYFMLYKNDPVGAIHNAESLR- Isotype
- IgG
- Antibody clone number
- 5F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Pathogenic mutations in the 5' untranslated region of BCS1L mRNA in mitochondrial complex III deficiency.
Gil-Borlado MC, González-Hoyuela M, Blázquez A, García-Silva MT, Gabaldón T, Manzanares J, Vara J, Martín MA, Seneca S, Arenas J, Ugalde C
Mitochondrion 2009 Sep;9(5):299-305
Mitochondrion 2009 Sep;9(5):299-305
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BCS1L expression in transfected 293T cell line by BCS1L monoclonal antibody (M01), clone 5F3.Lane 1: BCS1L transfected lysate(47.534 KDa).Lane 2: Non-transfected lysate.