Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations
 - Western blot [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00000617-M01 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00000617-M01, RRID:AB_509259
 - Product name
 - BCS1L monoclonal antibody (M01), clone 5F3
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant BCS1L.
 - Antigen sequence
 ASTEARIVFMTTNHVDRLDPALIRPGRVDLKEYVG
YCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATN
QISPAQVQGYFMLYKNDPVGAIHNAESLR- Isotype
 - IgG
 - Antibody clone number
 - 5F3
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
Submitted references		Pathogenic mutations in the 5' untranslated region of BCS1L mRNA in mitochondrial complex III deficiency.
				
		
	
			Gil-Borlado MC, González-Hoyuela M, Blázquez A, García-Silva MT, Gabaldón T, Manzanares J, Vara J, Martín MA, Seneca S, Arenas J, Ugalde C
Mitochondrion 2009 Sep;9(5):299-305
		Mitochondrion 2009 Sep;9(5):299-305
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of BCS1L expression in transfected 293T cell line by BCS1L monoclonal antibody (M01), clone 5F3.Lane 1: BCS1L transfected lysate(47.534 KDa).Lane 2: Non-transfected lysate.