HPA006655

TSTD1 antibody from Sigma-Aldrich
KAT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006655
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006655, RRID:AB_10600919
Product name
Anti-TSTD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006655
Antibody type
Polyclonal
Antigen
thiosulfate sulfurtransferase (rhodanese)-like domain containing 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAG
TIPGALNIPVSELESALQMEPAAFQALYSAEKPKL
EDEHLVFFCQMGKRGLQATQLARSLGYTGYG
Storage
-20C
Provider Type Product Number
- No reagents -