HPA027091

TTLL4 antibody from Sigma-Aldrich
KIAA0173
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027091
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027091, RRID:AB_10601828
Product name
Anti-TTLL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027091
Antibody type
Polyclonal
Antigen
tubulin tyrosine ligase-like family, member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGLEDCCSRDENEEEEGDSECSSLSAVSPSESVAM
ISRSCMEILTKPLSNHEKVVRPALIYSLFPNVPPT
IYFGTRDERVEKLPWEQRKLLRWKMSTVTPNIVKQ
TIGRSHFKISKRNDDWLGCWGHHMKSPSFRSI
Storage
-20C
Provider Type Product Number
- No reagents -