Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
- Flow cytometry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA22S - Provider product page

- Provider
- ReliaTech GmbH
- Product name
- VEGFR-3/FLT-4
- Antibody type
- Polyclonal
- Antigen
- recombinant human soluble FLT-4 (D1-7)
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
DPSGYSMTPPTLNITEDSYVIDTGDSLSISCRGQH
PLEWTWPGAQEVLTTGGKDSEDTRVVHDCEGTEAR
PYCKVLLLAQTHANNTGSYHCYYKYIKARIEGTTA
ASTYVFVRDFKHPFINKPDTLLVNRKDSMWVPCLV
SIPGLNITLRSQSSALHPDGQEVLWDDRRGMRVPT
QLLRDALYLQCETTWGDQNFLSNLFVVHITGNELY
DIQLYPKKSMELLVGEKLVLNCTVWAEFDSGVTFD
WDYPGKQAERAKWVPERRSQQTHTELSSILTIHNV
SQNDLGPYVCEANNGIQRFRESTEVIVHEKPFISV
EWLKGPVLEATAGDELVKLPVKLAAYPPPEFQWYK
DRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSA
AGLRQNISLELVVNVPPHIHEKEASSPSIYSRHSR
QTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSLR
RRQQRDGMPQCRDWKEVTTQDAVNPIESLDSWTEF
VEGKNKTVSKLVIQDANVSAMYKCVVVNKVGQDER
LIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRA
DNYTYEHLRWYRLNLSTLHDAQGNPLLLDCKNVHL
FATPLEANLEEAEPGARHATLSLNIPRVAPEDEGD
YVCEVQDRRSQDKHCHKKYLSVQALEAPRLTQNLT
DLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEK
ESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKG
CVNSSASVAVEGSEDKGSMEHHHHHH- Antibody clone number
- Rabbit IG
- Vial size
- 100 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Submitted references Endothelial EphB4 maintains vascular integrity and transport function in adult heart.
Functional Importance of a Proteoglycan Coreceptor in Pathologic LymphangiogenesisNovelty and Significance
Lymphatic Endothelial Heparan Sulfate Deficiency Results in Altered Growth Responses to Vascular Endothelial Growth Factor-C (VEGF-C)
Luxán G, Stewen J, Díaz N, Kato K, Maney SK, Aravamudhan A, Berkenfeld F, Nagelmann N, Drexler HC, Zeuschner D, Faber C, Schillers H, Hermann S, Wiseman J, Vaquerizas JM, Pitulescu ME, Adams RH
eLife 2019 Nov 29;8
eLife 2019 Nov 29;8
Functional Importance of a Proteoglycan Coreceptor in Pathologic LymphangiogenesisNovelty and Significance
Johns S, Yin X, Jeltsch M, Bishop J, Schuksz M, El Ghazal R, Wilcox-Adelman S, Alitalo K, Fuster M
Circulation Research 2016 July;119(2):210-221
Circulation Research 2016 July;119(2):210-221
Lymphatic Endothelial Heparan Sulfate Deficiency Results in Altered Growth Responses to Vascular Endothelial Growth Factor-C (VEGF-C)
Yin X, Johns S, Lawrence R, Xu D, Reddi K, Bishop J, Varner J, Fuster M
Journal of Biological Chemistry 2011 April;286(17):14952-14962
Journal of Biological Chemistry 2011 April;286(17):14952-14962
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Western analysis of recombinant human soluble VEGFR3/FLT-4 using a rabbit anti-human FLT-4 antibody [Cat# 102-PA22]. Lane ½: purified proteins; Lane 4/5: insect cells supernatant.
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Immunofluorescence staining of human VEGFR-3/FLT-4 (red) in hFlt4-transfected MG63 cells. Monoclonal mouse anti-human FLT-4 #9D9 [Cat# 101-M36] and polyclonal rabbit anti-human FLT-4 (D) [Cat# 102-PA22]: A and C are negative control with secondary antibody only; B (mAb) and D (pAb) with specific antibodies against human FLT-4. The experiment was performed by the research group of Dr. Wolfgang Holnthoner, Ludwig Boltzmann Institute for Experimental and Clinical Traumatology, Austrian Cluster for Tissue Regeneration, Donaueschingenstrasse 13, A-1200 Vienna, Austria
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- IHC with human spleen tissue sections. The experiment was performed by Prof. Dr. Birte Steiniger, Institute of Anatomy and Cell Biology Robert-Koch-Str. 8, D-35037 Marburg, Germany
- Sample type
- Human Spleen
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- FACS analysis with primary human dermal lymphatic endothelial cells (HDLEC).