102-PA22

FLT4 antibody from ReliaTech GmbH
PCL, VEGFR3
Western blot
Supportive data in Antibodypedia
Immunocytochemistry
Supportive data in Antibodypedia
Immunoprecipitation
Recommended by provider
Immunohistochemistry
Supportive data in Antibodypedia
Flow cytometry
Supportive data in Antibodypedia

Antibody data

Product number
102-PA22
Provider
ReliaTech GmbH
Product name
VEGFR-3/FLT-4
Provider product page
ReliaTech GmbH - 102-PA22
Antibody type
Polyclonal
Antigen
recombinant human soluble FLT-4 (D1-7)
Description
antibody Protein-A purified from serum
Reactivity
Human
Host
Rabbit
Antigen sequence
DPSGYSMTPPTLNITEDSYVIDTGDSLSISCRGQH
PLEWTWPGAQEVLTTGGKDSEDTRVVHDCEGTEAR
PYCKVLLLAQTHANNTGSYHCYYKYIKARIEGTTA
ASTYVFVRDFKHPFINKPDTLLVNRKDSMWVPCLV
SIPGLNITLRSQSSALHPDGQEVLWDDRRGMRVPT
QLLRDALYLQCETTWGDQNFLSNLFVVHITGNELY
DIQLYPKKSMELLVGEKLVLNCTVWAEFDSGVTFD
WDYPGKQAERAKWVPERRSQQTHTELSSILTIHNV
SQNDLGPYVCEANNGIQRFRESTEVIVHEKPFISV
EWLKGPVLEATAGDELVKLPVKLAAYPPPEFQWYK
DRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSA
AGLRQNISLELVVNVPPHIHEKEASSPSIYSRHSR
QTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSLR
RRQQRDGMPQCRDWKEVTTQDAVNPIESLDSWTEF
VEGKNKTVSKLVIQDANVSAMYKCVVVNKVGQDER
LIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRA
DNYTYEHLRWYRLNLSTLHDAQGNPLLLDCKNVHL
FATPLEANLEEAEPGARHATLSLNIPRVAPEDEGD
YVCEVQDRRSQDKHCHKKYLSVQALEAPRLTQNLT
DLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEK
ESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKG
CVNSSASVAVEGSEDKGSMEHHHHHH
Antibody clone number
Rabbit IG
Vial size
200 µl
Storage
Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
Handling
Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
Provider Type Product Number
- No reagents -