Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405845 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Wingless-Type MMTV Integration Site Family, Member 6 (WNT6) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLY
AADSP DFCAPNRRTG- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutation in WNT10A is associated with an autosomal recessive ectodermal dysplasia: the odonto-onycho-dermal dysplasia.
Adaimy L, Chouery E, Megarbane H, Mroueh S, Delague V, Nicolas E, Belguith H, de Mazancourt P, Megarbane A
American journal of human genetics 2007 Oct;81(4):821-8
American journal of human genetics 2007 Oct;81(4):821-8
No comments: Submit comment
No validations: Submit validation data