HPA028397

USP21 antibody from Sigma-Aldrich
USP16, USP23
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028397
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028397, RRID:AB_10603227
Product name
Anti-USP21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028397
Antibody type
Polyclonal
Antigen
ubiquitin specific peptidase 21 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CEAVNPTRFRAVFQKYVPSFSGYSQQDAQEFLKLL
MERLHLEINRRGRRAPPILANGPVPSPPRRGGALL
EEPELSDDDRANLMWKRYLEREDSKIVDLF
Storage
-20C
Provider Type Product Number
- No reagents -