Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005498-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005498-M01, RRID:AB_464235
- Product name
- PPOX monoclonal antibody (M01), clone 2F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PPOX.
- Antigen sequence
EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLV
HLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLA
GASYEGVAVNDCIESGRQAAVSVLGTEPNS- Isotype
- IgG
- Antibody clone number
- 2F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Improve efficacy of topical ALA-PDT by calcipotriol through up-regulation of coproporphyrinogen oxidase.
Methotrexate enhances 5-aminolevulinic acid-mediated photodynamic therapy-induced killing of human SCC4 cells by upregulation of coproporphyrinogen oxidase.
Posttranslational stability of the heme biosynthetic enzyme ferrochelatase is dependent on iron availability and intact iron-sulfur cluster assembly machinery.
Yang DF, Chen JH, Chiang CP, Huang Z, Lee JW, Liu CJ, Chang JL, Hsu YC
Photodiagnosis and photodynamic therapy 2014 Sep;11(3):331-41
Photodiagnosis and photodynamic therapy 2014 Sep;11(3):331-41
Methotrexate enhances 5-aminolevulinic acid-mediated photodynamic therapy-induced killing of human SCC4 cells by upregulation of coproporphyrinogen oxidase.
Yang DF, Lee JW, Chen HM, Huang Z, Hsu YC
Journal of the Formosan Medical Association = Taiwan yi zhi 2014 Feb;113(2):88-93
Journal of the Formosan Medical Association = Taiwan yi zhi 2014 Feb;113(2):88-93
Posttranslational stability of the heme biosynthetic enzyme ferrochelatase is dependent on iron availability and intact iron-sulfur cluster assembly machinery.
Crooks DR, Ghosh MC, Haller RG, Tong WH, Rouault TA
Blood 2010 Jan 28;115(4):860-9
Blood 2010 Jan 28;115(4):860-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PPOX expression in transfected 293T cell line by PPOX monoclonal antibody (M01), clone 2F10.Lane 1: PPOX transfected lysate(50.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PPOX is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PPOX on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol