Antibody data

Product number
H00005498-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005498-M09, RRID:AB_1137387
Product name
PPOX monoclonal antibody (M09), clone 2B7
Provider product page
Abnova Corporation - H00005498-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PPOX.
Antigen sequence
EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLV
HLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLA
GASYEGVAVNDCIESGRQAAVSVLGTEPNS
Isotype
IgG
Antibody clone number
2B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -