Antibody data

Product number
H00005498-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005498-M08, RRID:AB_1137389
Product name
PPOX monoclonal antibody (M08), clone 3H5
Provider product page
Abnova Corporation - H00005498-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PPOX.
Antigen sequence
EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLV
HLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLA
GASYEGVAVNDCIESGRQAAVSVLGTEPNS
Isotype
IgG
Antibody clone number
3H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -