PAB20054

HNRNPH2 antibody from Abnova Corporation
FTP3, hnRNPH', HNRPH', HNRPH2

Antibody data

Product number
PAB20054
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20054, RRID:AB_10961812
Product name
HNRNPH2 polyclonal antibody
Provider product page
Abnova Corporation - PAB20054
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant HNRNPH2.
Antigen sequence
DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVE
LFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYG
SQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQS
SMSGYDQVLQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -