Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20912 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20912, RRID:AB_10962033
- Product name
- HNRNPH2 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant HNRNPH2.
- Antigen sequence
FIYTREGRPSGEAFVELESEEEVKLALKKDRETMG
HRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVR
LRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQG
RSTGEAFVQFAS- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with HNRNPH2 polyclonal antibody (Cat # PAB20912) at 1:250-1:500 dilution.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of cell lysates with HNRNPH2 polyclonal antibody (Cat # PAB20912) at 1:250-1:500 dilution.Lane 1 : NIH/3T3Lane 2 : NBT-II
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A-431 with HNRNPH2 polyclonal antibody (Cat # PAB20912) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli, cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney with HNRNPH2 polyclonal antibody (Cat # PAB20912) shows nuclear positivity in both glomeruli and renal tubules at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)