PAB20912

HNRNPH2 antibody from Abnova Corporation
FTP3, hnRNPH', HNRPH', HNRPH2

Antibody data

Product number
PAB20912
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20912, RRID:AB_10962033
Product name
HNRNPH2 polyclonal antibody
Provider product page
Abnova Corporation - PAB20912
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant HNRNPH2.
Antigen sequence
FIYTREGRPSGEAFVELESEEEVKLALKKDRETMG
HRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVR
LRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQG
RSTGEAFVQFAS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -