HPA001359

HNRNPH2 antibody from Sigma-Aldrich
FTP3, hnRNPH', HNRPH', HNRPH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001359
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001359, RRID:AB_1079076
Product name
Anti-RPL36A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001359
Antibody type
Polyclonal
Antigen
60S ribosomal protein L36a (60S ribosomal protein L44) (Cell migration-inducing gene 6 protein)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVE
LFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYG
SQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQS
SMSGYDQVLQ
Storage
-20C
Provider Type Product Number
- No reagents -