HPA016884

HNRNPH2 antibody from Sigma-Aldrich
FTP3, hnRNPH', HNRPH', HNRPH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016884, RRID:AB_1856444
Product name
Anti-RPL36A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016884
Antibody type
Polyclonal
Antigen
Heterogeneous nuclear ribonucleoprotein H2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FIYTREGRPSGEAFVELESEEEVKLALKKDRETMG
HRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVR
LRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQG
RSTGEAFVQFAS
Storage
-20C
Provider Type Product Number
- No reagents -