H00006391-M01

SDHC antibody from Abnova Corporation
CYB560, cybL, PGL3

Antibody data

Product number
H00006391-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006391-M01, RRID:AB_425677
Product name
SDHC monoclonal antibody (M01), clone 3E2
Provider product page
Abnova Corporation - H00006391-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant SDHC.
Antigen sequence
MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAK
EEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSIC
HRGTGIALSAGVSLFGMSALLLPGNFESYLELVKS
LCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLG
KGLKIPQLYQSGVVVLVLTVLSSMGLAAM
Isotype
IgG
Antibody clone number
3E2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -