Antibody data

Product number
H00003310-M01
Provider
Abnova Corporation
Product name
HSPA6 monoclonal antibody (M01), clone 6H7
Provider product page
Abnova Corporation - H00003310-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HSPA6.
Antigen sequence
LEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCRE
VLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLY
GGPGVPGGSSCGTQARQGDPSTGPIIEEVD
Isotype
IgG
Antibody clone number
6H7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -