Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405956 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Chromosome 1 Open Reading Frame 111 (C1orf111) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C1orf111 antibody: synthetic peptide directed towards the middle region of human C1orf111
- Description
- Affinity Purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
CKVYYRKLKALWSKEQKARLGDRLSSGSCQAFNSP
AEHLR QIGGEAYLCL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Towards a proteome-scale map of the human protein-protein interaction network.
Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M
Nature 2005 Oct 20;437(7062):1173-8
Nature 2005 Oct 20;437(7062):1173-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting