Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Chromatin Immunoprecipitation [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504631 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Catenin beta-1 (CTNB1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRS
FHSGG YGQDALGMDP- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references DACT3 is an epigenetic regulator of Wnt/beta-catenin signaling in colorectal cancer and is a therapeutic target of histone modifications.
Jiang X, Tan J, Li J, Kivimäe S, Yang X, Zhuang L, Lee PL, Chan MT, Stanton LW, Liu ET, Cheyette BN, Yu Q
Cancer cell 2008 Jun;13(6):529-41
Cancer cell 2008 Jun;13(6):529-41
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- ChIP
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- ChIP