Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00117157-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00117157-M04, RRID:AB_1707651
- Product name
- SH2D1B monoclonal antibody (M04), clone 2B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SH2D1B.
- Antigen sequence
RIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEK
PNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNS
NSDYVDVLP- Isotype
- IgG
- Antibody clone number
- 2B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SH2D1B is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of SH2D1B transfected lysate using anti-SH2D1B monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SH2D1B MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol