H00127933-M02

UHMK1 antibody from Abnova Corporation
KIS, Kist
No application information provided.

Antibody data

Product number
H00127933-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00127933-M02, RRID:AB_1137523
Product name
UHMK1 monoclonal antibody (M02), clone 1H5
Provider product page
Abnova Corporation - H00127933-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant UHMK1.
Antigen sequence
MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSA
SVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAE
YGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVP
Isotype
IgG
Antibody clone number
1H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -