Antibody data

Product number
H00051478-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051478-M01, RRID:AB_1204501
Product name
HSD17B7 monoclonal antibody (M01), clone 1G10
Provider product page
Abnova Corporation - H00051478-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HSD17B7.
Antigen sequence
NAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSAT
TGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIR
VTIQKTDNQARLSGSCL
Isotype
IgG
Antibody clone number
1G10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -