Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051478-D01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051478-D01, RRID:AB_10718145
- Product name
- HSD17B7 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human HSD17B7 protein.
- Antigen sequence
MRKVVLITGASSGIGLALCKRLLAEDDELHLCLAC
RNMSKAEAVCAALLASHPTAEVTIVQVDVSNLQSV
FRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALF
FGLFSRKVIHMFSTAEGLLTQGDKITADGLQEVFE
TNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSAR
KSNFSLEDFQHSKGKEPYSSSKYATDLLSVALNRN
FNQQGLYSNVACPGTALTNLTYGILPPFIWTLLMP
AILLLRFFANAFTLTPYNGTEALVWLFHQKPESLN
PLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQK
LLELEKHIRVTIQKTDNQARLSGSCL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HSD17B7 expression in transfected 293T cell line (H00051478-T02) by HSD17B7 MaxPab polyclonal antibody.Lane 1: HSD17B7 transfected lysate(38.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of HSD17B7 transfected lysate using anti-HSD17B7 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HSD17B7 MaxPab mouse polyclonal antibody (B01) (H00051478-B01).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol