HPA028584

CCDC190 antibody from MilliporeSigma / Merck KGaA
C1orf110, MGC48998
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028584
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028584, RRID:AB_10599423
Product name
Anti-C1orf110 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028584
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein C1orf110 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LYKHFDLERKNAKQAEARLDQRLQRLKVICLYHVK
LLTWEQRQLQKELQRLQQETMKKKFSSYLGNGFQK
RPEDVLVFSPQGR
Storage
-20C
Provider Type Product Number
- No reagents -