Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA08 - Provider product page

- Provider
- ReliaTech GmbH
- Product name
- FGF-2 (basic)
- Antibody type
- Polyclonal
- Antigen
- Recombinant human FGF-2 (basic)
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
AGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNG
GFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVV
SIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPG
QKAILFLPMSAKS- Antibody clone number
- Rabbit IG
- Vial size
- 200 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- Western analysis of recombinant human (RT# 300-003), mouse (RT# M30-015) and rat (RT# R20-060) FGF-2 (basic) using a polyclonal antibody directed against recombinant human FGF-2. As expected the antibody cross reacts with the mouse and rat proteins.
- Sample type
- Purified recombinant proteins
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image

- Experimental details
- FGF-2 Sandwich-ELISA using a polyclonal goat anti-human FGF-2 [sc-1390] as capture antibody and recombinant human FGF-2 [Cat# 300-002] as standard. The polyclonal rabbit anti-human FGF-2 antibody [Cat# 102-PA08] in combination with a goat anti-rabbit-Biotin was used for detection.