Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN487226 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Transmembrane and Coiled-Coil Domains 1 (TMCO1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMCO1 antibody: synthetic peptide directed towards the C terminal of human TMCO1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAG
GFLGP PPPSGKFS- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Association of genetic variants in the TMCO1 gene with clinical parameters related to glaucoma and characterization of the protein in the eye.
Genome-wide association study identifies susceptibility loci for open angle glaucoma at TMCO1 and CDKN2B-AS1.
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Sharma S, Burdon KP, Chidlow G, Klebe S, Crawford A, Dimasi DP, Dave A, Martin S, Javadiyan S, Wood JP, Casson R, Danoy P, Griggs K, Hewitt AW, Landers J, Mitchell P, Mackey DA, Craig JE
Investigative ophthalmology & visual science 2012 Jul 24;53(8):4917-25
Investigative ophthalmology & visual science 2012 Jul 24;53(8):4917-25
Genome-wide association study identifies susceptibility loci for open angle glaucoma at TMCO1 and CDKN2B-AS1.
Burdon KP, Macgregor S, Hewitt AW, Sharma S, Chidlow G, Mills RA, Danoy P, Casson R, Viswanathan AC, Liu JZ, Landers J, Henders AK, Wood J, Souzeau E, Crawford A, Leo P, Wang JJ, Rochtchina E, Nyholt DR, Martin NG, Montgomery GW, Mitchell P, Brown MA, Mackey DA, Craig JE
Nature genetics 2011 Jun;43(6):574-8
Nature genetics 2011 Jun;43(6):574-8
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
Cell 2006 Nov 3;127(3):635-48
Cell 2006 Nov 3;127(3):635-48
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting