Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029926-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029926-M01, RRID:AB_606309
- Product name
- GMPPA monoclonal antibody (M01), clone 2F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GMPPA.
- Antigen sequence
ESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEG
TPSDPNPNDPRARMDSESLFKDGKLLPAITILGCR
VRIPAEVLILNSIVLPHKELSRSFTNQIIL- Isotype
- IgG
- Antibody clone number
- 2F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GMPPA expression in transfected 293T cell line by GMPPA monoclonal antibody (M01), clone 2F1.Lane 1: GMPPA transfected lysate(46.291 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of GMPPA transfected lysate using anti-GMPPA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GMPPA monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol