HPA028651

TADA1 antibody from MilliporeSigma / Merck KGaA
ADA1, hADA1, HFI1, STAF42, TADA1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028651
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028651, RRID:AB_10602476
Product name
Anti-TADA1L antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028651
Antibody type
Polyclonal
Antigen
transcriptional adaptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLPASLPPVNMYDLFEALQVHREVIPTHTVYALNI
ERIITKLWHPNHEELQQDKVHRQRLAAKE
Storage
-20C
Provider Type Product Number
- No reagents -