HPA030852

DCAF6 antibody from MilliporeSigma / Merck KGaA
IQWD1, PC326
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030852
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030852, RRID:AB_10602911
Product name
Anti-IQWD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030852
Antibody type
Polyclonal
Antigen
DDB1 and CUL4 associated factor 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KFLPCTNDKQIVSCSGDGVIFYTNVEQDAETNRQC
QFTCHYGTTYEIMTVPNDPYTFLSCGEDGTVRWFD
TRIKTSCTKEDCKDDILINCRRAATSVAICPP
Storage
-20C
Provider Type Product Number
- No reagents -