HPA017324

VIP antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017324
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017324, RRID:AB_1858754
Product name
Anti-VIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017324
Antibody type
Polyclonal
Antigen
VIP peptides Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRN
ARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSS
NISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLN
SILNGKRSSEGESPDFPE
Storage
-20C
Provider Type Product Number
- No reagents -