HPA027189

CCDC181 antibody from Sigma-Aldrich
C1orf114, FLJ25846
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027189
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027189, RRID:AB_10599252
Product name
Anti-C1orf114 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027189
Antibody type
Polyclonal
Antigen
Uncharacterized protein C1orf114 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVRRYIMEKIVQANKLLQNQEPVNDKRERKLKFKD
QLVDLEVPPLEDTTTSKNYFENERNMFGKLSQLCI
SNDFGQEDVLLSLTNGSCE
Storage
-20C
Provider Type Product Number
- No reagents -