ABIN311273

antibody from antibodies-online

Targeting: MOGAT1 DGAT2L, DGAT2L1, MGAT1

Western blot (Data presented on provider website)

Antibody Data

Product number

ABIN311273

Provider

antibodies-online

Product name

anti-Monoacylglycerol O-Acyltransferase 1 (MOGAT1) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-MOGAT1 antibody: synthetic peptide directed towards the C terminal of human MOGAT1

Reactivity

Human, Mouse, Bovine, Canine, Xenopus

Host

Rabbit

Antigen sequence

PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKG
KYGIP EHETLVLK


Vial size

50 µg

References

Submitted references

Generation and annotation of the DNA sequences of human chromosomes 2 and 4.

Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK
Nature 2005 Apr 7;434(7034):724-31