H00065080-B01

MRPL44 antibody from Abnova Corporation
FLJ12701, FLJ13990

Antibody data

Product number
H00065080-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00065080-B01, RRID:AB_1577433
Product name
MRPL44 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00065080-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MRPL44 protein.
Antigen sequence
MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGF
RAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHA
EIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKR
QQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQF
LEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAV
EQLTLSEEFPVPPAVLQQTFFAVIGALLQSSGPER
TALFIRDFLITQMTGKELFEMWKIINPMGLLVEEL
KKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKL
IAEGPGETVLVAEEEAARVALRKLYGFTENRRPWN
YSKPKETLRAEKSITAS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -