H00092344-B01

GORAB antibody from Abnova Corporation
FLJ11752, GO, NTKL-BP1, SCYL1BP1

Antibody data

Product number
H00092344-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00092344-B01, RRID:AB_1138725
Product name
SCYL1BP1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00092344-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SCYL1BP1 protein.
Antigen sequence
MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSE
EELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALV
EQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPF
SSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENS
HDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQ
QEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKL
KRIQKELQALDDMVSADIGILRNRIDQASLDYSYA
R
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -