HPA027250

GORAB antibody from Sigma-Aldrich
FLJ11752, GO, NTKL-BP1, SCYL1BP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027250
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027250, RRID:AB_10611253
Product name
Anti-GORAB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027250
Antibody type
Polyclonal
Antigen
golgin, RAB6-interacting recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLEN
SHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVL
QQEQRLME
Storage
-20C
Provider Type Product Number
- No reagents -