Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005396-M01 - Provider product page

- Provider
- Abnova Corporation
- Product name
- PRRX1 monoclonal antibody (M01), clone 1E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PRRX1.
- Antigen sequence
MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFS
VSHLLDLEEAGDMVAAQADENVGEAGRSLLESPGL
TSGSDTPQQDNDQLNSEEKK- Isotype
- IgG
- Antibody clone number
- 1E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Downregulation of PRRX1 Confers Cancer Stem Cell-Like Properties and Predicts Poor Prognosis in Hepatocellular Carcinoma.
Hirata H, Sugimachi K, Takahashi Y, Ueda M, Sakimura S, Uchi R, Kurashige J, Takano Y, Nanbara S, Komatsu H, Saito T, Shinden Y, Iguchi T, Eguchi H, Atsumi K, Sakamoto K, Doi T, Hirakawa M, Honda H, Mimori K
Annals of surgical oncology 2015 Dec;22 Suppl 3:S1402-9
Annals of surgical oncology 2015 Dec;22 Suppl 3:S1402-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PRRX1 expression in transfected 293T cell line by PRRX1 monoclonal antibody (M01), clone 1E2.Lane 1: PRRX1 transfected lysate (Predicted MW: 24.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PRRX1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol