Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042064 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042064, RRID:AB_10794410
- Product name
- Anti-COL4A3
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDI
GPPGFRGPTEYYDTYQEKGDEGTPGPPGPRGARG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Exogenous supply of Hsp47 triggers fibrillar collagen deposition in skin cell cultures in vitro
Everolimus Stabilizes Podocyte Microtubules via Enhancing TUBB2B and DCDC2 Expression
Khan E, Sankaran S, Llontop L, del Campo A
BMC Molecular and Cell Biology 2020;21(1)
BMC Molecular and Cell Biology 2020;21(1)
Everolimus Stabilizes Podocyte Microtubules via Enhancing TUBB2B and DCDC2 Expression
Dryer S, Jeruschke S, Jeruschke K, DiStasio A, Karaterzi S, Büscher A, Nalbant P, Klein-Hitpass L, Hoyer P, Weiss J, Stottmann R, Weber S
PLOS ONE 2015;10(9):e0137043
PLOS ONE 2015;10(9):e0137043
No comments: Submit comment
No validations: Submit validation data