Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038898 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA038898, RRID:AB_10673481
- Product name
- Anti-SLC19A3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSG
KLNKGQLNSLKPSNVTVDVFVQWFQDLKECY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Reduced Thiamine Availability and Hyperglycemia Impair Thiamine Transport in Renal Glomerular Cells through Modulation of Thiamine Transporter 2
Thiamine transporter 2 is involved in high glucose-induced damage and altered thiamine availability in cell models of diabetic retinopathy
Metformin Is a Substrate and Inhibitor of the Human Thiamine Transporter, THTR-2 (SLC19A3)
Mazzeo A, Barutta F, Bellucci L, Trento M, Gruden G, Porta M, Beltramo E
Biomedicines 2021;9(4):385
Biomedicines 2021;9(4):385
Thiamine transporter 2 is involved in high glucose-induced damage and altered thiamine availability in cell models of diabetic retinopathy
Beltramo E, Mazzeo A, Lopatina T, Trento M, Porta M
Diabetes and Vascular Disease Research 2019;17(1):147916411987842
Diabetes and Vascular Disease Research 2019;17(1):147916411987842
Metformin Is a Substrate and Inhibitor of the Human Thiamine Transporter, THTR-2 (SLC19A3)
Liang X, Chien H, Yee S, Giacomini M, Chen E, Piao M, Hao J, Twelves J, Lepist E, Ray A, Giacomini K
Molecular Pharmaceutics 2015;12(12):4301-4310
Molecular Pharmaceutics 2015;12(12):4301-4310
No comments: Submit comment
No validations: Submit validation data