HPA031657

ANKRD45 antibody from MilliporeSigma / Merck KGaA
CT117, FLJ45235
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031657
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031657, RRID:AB_10602196
Product name
Anti-ANKRD45 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031657
Antibody type
Polyclonal
Antigen
ankyrin repeat domain 45 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEDKNTILSACRAKNEWLETHTEASINELFEQRQQ
LEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDD
TSN
Storage
-20C
Provider Type Product Number
- No reagents -