HPA019475

MINDY4 antibody from Atlas Antibodies
C7orf67, FAM188B, FLJ22374

Antibody data

Product number
HPA019475
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019475, RRID:AB_1848806
Product name
Anti-MINDY4
Provider product page
Atlas Antibodies - HPA019475
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TTLVNIYDLSDEDAGWRTSLSETSKARHDNLDGDV
LGNFVSSKRPPHKSKPMQTVPGETPVLTSAWEKID
KLHSEPSLDVKRMGENSRPKSGLIV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.