HPA030129

MINDY4 antibody from MilliporeSigma / Merck KGaA
C7orf67, FAM188B, FLJ22374
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030129
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030129, RRID:AB_10599621
Product name
Anti-FAM188B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030129
Antibody type
Polyclonal
Antigen
family with sequence similarity 188, member B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VQGCVLQKLLFEGDSKADCAQGLQPSDAHRTRCLV
LALADIVWRAGGRERAVVALASRTQQFSPTGKYKA
DGVLETLTLHSLTCYEDLVTFLQQSIHQFEVGPYG
CILLTLSAILSRSTELIRQDFDVPTS
Storage
-20C
Provider Type Product Number
- No reagents -